PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02823g04001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 355aa    MW: 40347 Da    PI: 6.3057
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02823g04001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092823162155
                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                               k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  Niben101Scf02823g04001.1 282 KWPYPSESEKVALAETTGLDQKQINNWFINQRKRH 316
                               669*****************************885 PP

2ELK383.6e-13236257122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               ELK++LlrKYsgyL+sLkqE+s
  Niben101Scf02823g04001.1 236 ELKNHLLRKYSGYLSSLKQELS 257
                               9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.9E-20102146IPR005540KNOX1
PfamPF037901.5E-22103145IPR005540KNOX1
SMARTSM012565.9E-23153204IPR005541KNOX2
PfamPF037914.4E-23157202IPR005541KNOX2
SMARTSM011883.5E-7236257IPR005539ELK domain
PfamPF037892.5E-10236257IPR005539ELK domain
PROSITE profilePS5121311.296236256IPR005539ELK domain
PROSITE profilePS5007112.924256319IPR001356Homeobox domain
SuperFamilySSF466891.63E-19257331IPR009057Homeodomain-like
SMARTSM003895.4E-13258323IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-27261322IPR009057Homeodomain-like
CDDcd000861.06E-11268320No hitNo description
PfamPF059208.3E-17276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MENNYNQLGE NSSQRGNNFL YGGIPLLASP NSSIYGRTSG GGGGGCDCYD QSQAVVHPIV  60
KTEGGSTSHH HTFQHPSRIR SGYHHQTVQN HHESESSGSE VDALKAKIIA HPQCSNLLGA  120
YMDCQKVGAP PEVVARLSAV RQEFEVRQLD SSTDKDVSKD PELDQFMEAY YDMLVKYREE  180
LTRPLHEAMD FMRKIETQLN MLEDKCEGVG SSEEEQDNSG GETEIPEIDP RAEDRELKNH  240
LLRKYSGYLS SLKQELSKKK KKGKLPKDAR QKLLSWWELH YKWPYPSESE KVALAETTGL  300
DQKQINNWFI NQRKRHWKPS EDMQFMVMDG LHPQNAAALY MEGHYMAEGP FRLGQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760091.10.0PREDICTED: homeotic protein knotted-1 isoform X2
RefseqXP_016442877.10.0PREDICTED: homeotic protein knotted-1-like isoform X2
SwissprotQ413300.0KN1_SOLLC; Homeotic protein knotted-1
TrEMBLV9LXK80.0V9LXK8_TOBAC; Knotted 1
STRINGPGSC0003DMT4000127120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-131KNOTTED-like from Arabidopsis thaliana